Yahoo Canada Web Search

Search results

1. Dictionary

   want

   /wɒnt/

   verb

   • 1. have a desire to possess or do (something); wish for: "I want an apple" Similar desirewish forhope forfancyhave a fancy fortake a fancy tohave an inclination forcare forlikeset one's heart onlong foryearn forpine forsigh forcravehanker afterhunger forthirst forlust aftercry out forbe desperate foritch forcovetneedbe bent oninformal:have a yen forbe dying for
   • ▪ wish to speak to (someone): "Tony wants me in the studio"
   • ▪ (of a suspected criminal) be sought by the police for questioning: "he is wanted by the police in connection with an arms theft"
   • ▪ desire (someone) sexually: "I've wanted you since the first moment I saw you"
   • ▪ desire to be in or out of a particular place or situation: informal North American "if anyone wants out, there's the door"
   • 2. should or need to do something: informal "you don't want to believe everything you hear" Similar shouldoughtneedmust
   • ▪ (of a thing) require to be attended to in a specified way: British "the wheel wants greasing" Similar needbe/stand in need ofrequiredemandcry out for
   • 3. lack something desirable or essential: literary "you shall want for nothing while you are with me"
   • ▪ (chiefly used in expressions of time) lack or be short of (a specified amount or thing): archaic "it wanted twenty minutes to midnight"

   noun

   • 1. a lack or deficiency of something: "Victorian houses which are in want of repair" Similar lackabsencenon-existenceunavailabilitydearthdeficiencyinadequacyinsufficiencypaucityshortageshortfallshortnessscarcityscarcenessscantinessundersupplydeficitrare:exiguityOpposite abundancepresence
   • ▪ the state of being poor and in need of essentials; poverty: "freedom from want" Similar needneedinessausterityprivationdeprivationpovertyimpoverishmentimpecuniousnessimpecuniositypennilessnesspauperismpenurydestitutionfaminedroughtindigenceOpposite wealthplenty
   • 2. a desire for something: "the expression of our wants and desires" Similar wishdesiredemandlongingyearningfancycravinghankeringneedrequirementnecessityessentialrequisiteinformal:yen

   Word Origin Middle English: the noun from Old Norse vant, neuter of vanr ‘lacking’; the verb from Old Norse vanta‘be lacking’. The original notion of ‘lack’ was early extended to ‘need’ and from this developed the sense ‘desire’.

   Derivatives

   • 1. wanter noun

   Scrabble Points: 7

   • W

     4

   • A

     1

   • N

     1

   • T

     1

   Powered by Oxford Dictionaries

   More definitions, origin and scrabble points

2. www.answers.com › marketing › Define_'want'_in_busines_termsDefine 'want' in busines terms - Answers

   www.answers.com › marketing › Define_'want'_in_busines_terms

   • Cached

   Sep 17, 2023 · define 'Want' in marketing terms. Wiki User. ∙ 14y ago. This answer is:

3. www.answers.com › marketing › Define_marketingDefine marketing? - Answers

   www.answers.com › marketing › Define_marketing

   • Cached

   Sep 14, 2023 · Marketing is a societal process which discerns consumers' wants, focusing on a product or service to fulfill those wants, attempting to move the consumers toward the products or services offered.

4. www.answers.com › marketing › Why_do_marketers_define_products_in_terms_of_benefitsWhy do marketers define products in terms of benefits?

   www.answers.com › marketing › Why_do_marketers_define_products_in_terms_of_benefits

   • Cached

   Sep 11, 2023 · Define 'want' in busines terms? define 'Want' in marketing terms. How are defined terms and undefined terms relate to each other? "Defined items" are defined in terms of "undefined terms".

5. www.answers.com › math-and-arithmetic › What_terms_define_a_relationWhat terms define a relation? - Answers

   www.answers.com › math-and-arithmetic › What_terms_define_a_relation

   • Cached

   Sep 24, 2023 · define 'Want' in marketing terms. What is the function of relation domain and range in mathematics? A relation is a mapping from elements of one set, called the domain, to elements of another set ...

6. www.answers.com › marketing › Define_Promotion_prone_consumers_in_MarketingDefine Promotion prone consumers in Marketing Advertising and ......

   www.answers.com › marketing › Define_Promotion_prone_consumers_in_Marketing

   • Cached

   Sep 15, 2023 · Define marketing? Marketing is a societal process which discerns consumers' wants, focusing on a product or service to fulfill those wants, attempting to move the consumers toward the products or ...

7. www.answers.com › philosophy › What_does_'Study_the_past_if_you_would_define_theWhat does 'Study the past if you would define the future' mean?

   www.answers.com › philosophy › What_does_'Study_the_past_if_you_would_define_the

   • Cached

   May 1, 2024 · First of all, the quote has a popular mistake. The actual quote uses to the "divine" not "define." What does divine mean? Archaically, it meant the ability to prophesy (i.e., to predict the future ...

8. www.answers.com › biology › Define_Ecosystem_in_terms_of_inputs_and_outputsDefine Ecosystem in terms of inputs and outputs? - Answers

   www.answers.com › biology › Define_Ecosystem_in_terms_of_inputs_and_outputs

   • Cached

   Jun 13, 2024 · Define 'want' in busines terms? define 'Want' in marketing terms. How are defined terms and undefined terms relate to each other? "Defined items" are defined in terms of "undefined terms".

9. www.answers.com › jobs › Define_the_terms_sanitation_and_contaminationDefine the terms sanitation and contamination? - Answers

   www.answers.com › jobs › Define_the_terms_sanitation_and_contamination

   • Cached

   define 'Want' in marketing terms. How are defined terms and undefined terms relate to each other? "Defined items" are defined in terms of "undefined terms". In terms of cooking what is sanitation?

10. www.answers.com › marketing › An_organization_should_define_its_business_in_termsAn organization should define its business in terms of its?

    www.answers.com › marketing › An_organization_should_define_its_business_in_terms

    • Cached

    Sep 17, 2023 · Define 'want' in busines terms? define 'Want' in marketing terms. Describe how your organisation's service offer meets customer expectations? First, you should research the expectations of your ...

11. www.answers.com › travel-destinations › Define_a_place_in_geographical_termsDefine a place in geographical terms? - Answers

    www.answers.com › travel-destinations › Define_a_place_in_geographical_terms

    • Cached

    Sep 16, 2023 · define 'Want' in marketing terms. What do the five themes of geography do? AnswerThe five themes of geography are location, place,human-environmental interaction,movement, and regions.They define ...