Yahoo Canada Web Search

Search results

1. Dictionary

   temper

   /ˈtɛmpə/

   noun

   • 1. a person's state of mind seen in terms of their being angry or calm: "he rushed out in a very bad temper" Similar temperamentdispositionnaturecharacterpersonalitymake-upconstitutionmindspiritstampmettlemouldmoodframe of mindcast of mindhabit of mindattitudearchaic:humourgrain
   • ▪ a tendency to become angry easily: "I know my temper gets the better of me at times" Similar angerfuryrageannoyancevexationcrossnessirascibilityirritationirritabilityill humourill temperdyspepsiaspleenpiquepetulancepeevishnesspettishnesstestinesstetchinesssnappishnesscrabbinessresentmentsurlinesschurlishnessair rageinformal:stroppinessliterary:irecholerOpposite good humour
   • ▪ an angry state of mind: "Drew had walked out in a temper" Similar fit of rageragefuryfit of bad/ill temperbad tempertantrumpassionparoxysmfit of piquebad moodmoodpetsulkmardinformal:grumphuffsnitstroppaddyinformal, dated:batewaxskidinformal:blowouthissy fitarchaic:paddywhackmiff
   • 2. the degree of hardness and elasticity in steel or other metal: "the blade rapidly heats up and the metal loses its temper"

   verb

   • 1. improve the hardness and elasticity of (steel or other metal) by reheating and then cooling it: "the way a smith would temper a sword"
   • ▪ improve the consistency or resiliency of (a substance) by means of a process involving heat or chemicals: "the display is a single sheet of glass, tempered for strength" Similar hardenstrengthentoughenfortifytechnical:anneal
   • 2. act as a neutralizing or counterbalancing force to (something): "their idealism is tempered with realism" Similar moderatemodifymodulatetone downmitigatepalliatealleviateallayassuagelessenreduceweakenlightensoftencushionqualify
   • 3. tune (a piano or other instrument) so as to adjust the note intervals correctly.

   Word Origin Old Englishtemprian ‘bring something into the required condition by mixing it with something else’, from Latin temperare ‘mingle, restrain’. Sense development was probably influenced by Old French temprer ‘to temper, moderate’. The noun originally denoted a proportionate mixture of elements or qualities, also the combination of the four bodily humours, believed in medieval times to be the basis of temperament, hence temper (sense 1 of the noun) (late Middle English). Compare with temperament.

   Derivatives

   • 1. temperer noun
   • 2. temperative adjective

   Scrabble Points: 10

   • T

     1

   • E

     1

   • M

     3

   • P

     3

   • E

     1

   • R

     1

   Powered by Oxford Dictionaries

   More definitions, origin and scrabble points

2. People also ask

   What does temper mean in English?

   • Temper can also be used as a verb meaning “to restrain.” If you have a nasty temper, you might try tempering your temper by counting to ten whenever you’re tempted to throw a "temper tantrum," or fit. show 7 types...

   Temper - Definition, Meaning & Synonyms | Vocabulary.com

   www.vocabulary.com/dictionary/temper

   See all results for this question

   What does temper mean in metallurgy?

   • a particular state of mind or feelings. an even temper. to be out of temper. a substance added to something to modify its properties or qualities. Metallurgy. the degree of hardness and strength imparted to a metal, as by quenching, heat treatment, or cold working. the percentage of carbon in tool steel. the operation of tempering.

   TEMPER Definition & Meaning | Dictionary.com

   www.dictionary.com/browse/temper

   See all results for this question

   What is a temper designation?

   • As noted earlier, temper designations are alphanumeric designations appended to the alloy designations that convey to the producer and user alike information about the general manner in which the alloy has been mechanically and/or thermally treated to achieve the properties desired.

   Understanding the Aluminum Temper Designation System

   materialsdata.nist.gov/bitstream/handle/11115/186/Understanding Temper Designation.pdf?sequence=3

   See all results for this question

   What does it mean if you are in a bad temper?

   • If you are in a bad temper, you feel angry and impatient. I was in a bad temper last night. He was in a very good temper. In a fit of bad temper, Dougie threw the deep fat fryer overboard. To temper something means to make it less extreme. For others, especially the young and foolish, the state will temper justice with mercy.

   TEMPER definition and meaning | Collins English Dictionary

   www.collinsdictionary.com/dictionary/english/temper

   See all results for this question

3. www.merriam-webster.com › dictionary › temperTemper Definition & Meaning - Merriam-Webster

   www.merriam-webster.com › dictionary › temper

   • Cached

   Learn the various meanings and uses of the word temper as a noun and a verb, with synonyms, examples, and word history. Find out how temper relates to heat, emotion, quality, state, and balance.

4. dictionary.cambridge.org › dictionary › englishTEMPER | English meaning - Cambridge Dictionary

   dictionary.cambridge.org › dictionary › english

   • Cached

   Learn the meaning of temper as a noun and a verb, with synonyms, antonyms, idioms and examples. Find out how to use temper in different contexts, such as mood, metal, food and glass.

5. Videos

   • 

     collinsdictionary.com

     TEMPER definition and meaning | Collins English Dictionary

     Dec 24, 2011

   • 

     0:39

     youtube.com

     Temper Meaning

     Apr 20, 2015

     11.8K Views

   • 

     3:32

     youtube.com

     Temper | Meaning of temper

     Mar 7, 2019

     6.3K Views

   View all

6. www.vocabulary.com › dictionary › temperTemper - Definition, Meaning & Synonyms | Vocabulary.com

   www.vocabulary.com › dictionary › temper

   Temper can refer to a tendency to become unreasonably angry. If you’re not sure whether you have a temper, ask your friends — but don’t get mad if you dislike what they have to say.

7. www.dictionary.com › browse › temperTEMPER Definition & Meaning | Dictionary.com

   www.dictionary.com › browse › temper

   • Cached

   Temper definition: a particular state of mind or feelings.. See examples of TEMPER used in a sentence.

8. www.collinsdictionary.com › dictionary › englishTEMPER definition and meaning | Collins English Dictionary

   www.collinsdictionary.com › dictionary › english

   • Cached

   Learn the meaning, pronunciation, and usage of the word 'temper' in British and American English. Find synonyms, examples, and related words for 'temper' in different contexts.

9. dictionary.cambridge.org › learner-english › temperTEMPER | meaning - Cambridge Learner's Dictionary

   dictionary.cambridge.org › learner-english › temper

   • Cached

   Learn the meaning of temper as a noun and a verb, and how to use it in different contexts. Find out the synonyms, antonyms, and translations of temper in other languages.

10. www.ldoceonline.com › dictionary › tempertemper | meaning of temper in Longman Dictionary of ...

    www.ldoceonline.com › dictionary › temper

    • Cached

    Learn the meaning of temper as a noun and a verb, with synonyms, collocations and examples. Find out how to use temper in phrases like lose your temper, fly into a temper, temper of the times and more.