Yahoo Canada Web Search

Search results

1. Dictionary

   forward

   /ˈfɔːwəd/

   adverb

   • 1. in the direction that one is facing or travelling; towards the front: "he started up the engine and the car moved forward" Similar aheadforwardsonwardsonwardonfurther
   • ▪ in or towards the bow or nose of a ship or aircraft.
   • ▪ in the normal order or sequence: "the number was the same backwards as forwards"
   • 2. onward so as to make progress: "the signing of the treaty is a big step forward" Similar moving forwardsmoving aheadonwardadvancingprogressingprogressiveOpposite backward
   • ▪ into a position of prominence or notice: "he is pushing forward a political ally" Similar towards the frontfrontwardsoutforthinto viewinto the openinto public noticeinto prominence
   • 3. towards the future; ahead in time: "looking forward, earnings are expected to hit £7.2 billion" Similar onwardonwardsonforthforwardsfor everinto eternityuntil now
   • ▪ to an earlier time: "the special issue has been moved forward to November"

   adjective

   • 1. directed or facing towards the front or the direction that one is facing or travelling: "forward flight" Similar moving forwardsmoving aheadonwardadvancingprogressingprogressiveOpposite backward
   • ▪ positioned near the enemy lines: "troops moved to the forward areas" Similar frontadvanceforemostheadleadingfrontalOpposite rear
   • ▪ situated in or towards the bow or nose of a ship or aircraft: "the forward cargo doors"
   • ▪ (of a voltage applied to a semiconductor junction) in the direction which allows significant current to flow.
   • 2. relating to the future: "a twelve-month forward forecast" Similar futureforward-lookingfor the futureprospective
   • 3. progressing towards a successful conclusion: "the decision is a forward step"
   • ▪ further advanced than expected or required: "an alarmingly forward yet painfully vulnerable child" Similar advancedwell advancedearlyprematureprecociousOpposite late
   • 4. (of a person) bold or overfamiliar in manner: "I am not usually a forward sort of person" Similar boldbrazenbrazen-facedbarefacedbrashshamelessimmodestaudaciousdaringpresumptuouspresumingassumingfamiliaroverfamiliarirreverentover-assertiveoverconfidentoverweeningaggressivethrustingpertimpudentimpertinentcheekyinsolentunabashedinformal:brass-neckedcockyfreshOpposite shy

   noun

   • 1. an attacking player in football, hockey, or other sports.
   • 2. agreements to trade specified assets, typically currency, at a specified price at a certain future date.

   verb

   • 1. send (a letter or email) on to a further destination: "my emails were forwarded to a friend" Similar send onredirectreaddresspass onpost on
   • ▪ dispatch or send (a document or goods): "we will forward the parcels to you anywhere in the world" Similar senddispatchtransmitcarryconveydeliverremitmailshipfreightpost
   • 2. help to advance (something); promote: "the scientists are forwarding the development of biotechnology" Similar advancefurtherhastenhurry alongexpediteacceleratespeed upstep upaidassisthelpfosterencouragecontribute topromotefavoursupportbackgive backing tofacilitate

   Word Origin Old Englishforweard (in the sense ‘towards the future’, as in from this day forward), variant of forthweard (see forth, -ward).

   Derivatives

   • 1. forwardly adverb

   Scrabble Points: 14

   • F

     4

   • O

     1

   • R

     1

   • W

     4

   • A

     1

   • R

     1

   • D

     2

   Powered by Oxford Dictionaries

   More definitions, origin and scrabble points

2. www.merriam-webster.com › dictionary › forwardForward Definition & Meaning - Merriam-Webster

   www.merriam-webster.com › dictionary › forward

   • Cached

   The meaning of FORWARD is near, being at, or belonging to the forepart. How to use forward in a sentence. Synonym Discussion of Forward.

3. www.dictionary.com › browse › forwardFORWARD Definition & Meaning | Dictionary.com

   www.dictionary.com › browse › forward

   • Cached

   Forward definition: toward or at a place, point, or time in advance; onward; ahead. See examples of FORWARD used in a sentence.

4. www.collinsdictionary.com › dictionary › englishFORWARD definition and meaning | Collins English Dictionary

   www.collinsdictionary.com › dictionary › english

   • Cached

   If something or someone is put forward, or comes forward, they are suggested or offered as suitable for a particular purpose. Over the years several similar theories have been put forward. Next month the Commission is to bring forward its first proposals for action.

5. dictionary.cambridge.org › dictionary › englishFORWARD | English meaning - Cambridge Dictionary

   dictionary.cambridge.org › dictionary › english

   • Cached

   FORWARD definition: 1. towards the direction that is in front of you: 2. towards the goal or area that is defended by…. Learn more.

6. www.vocabulary.com › dictionary › forwardForward - Definition, Meaning & Synonyms | Vocabulary.com

   www.vocabulary.com › dictionary › forward

   Forward is the direction ahead of you, or toward the front of something. It can also be a position on a basketball, soccer, or hockey team. Forward can be a direction of either space or time, and also implies progress. A forward-thinking person thinks about what will happen in the future.

7. www.thefreedictionary.com › forwardForward - definition of forward by The Free Dictionary

   www.thefreedictionary.com › forward

   • Cached

   1. a. At, near, or belonging to the front or forepart; fore: the forward section of the aircraft. b. Located ahead or in advance: kept her eye on the forward horizon. 2. a. Going, tending, or moving toward a position in front: a forward plunge down a flight of stairs. b. Sports Advancing toward an opponent's goal.

8. dictionary.cambridge.org › us › dictionaryFORWARD | definition in the Cambridge Learner’s Dictionary

   dictionary.cambridge.org › us › dictionary

   • Cached

   FORWARD meaning: 1. towards the direction that is in front of you: 2. towards the future: 3. used to say that…. Learn more.

9. www.collinsdictionary.com › us › dictionaryFORWARD definition in American English | Collins English ...

   www.collinsdictionary.com › us › dictionary

   • Cached

   1. adverb [ADV after v] If you move or look forward, you move or look in a direction that is in front of you. He came forward with his hand out. "Mr. and Mrs. Selby?" he said. She fell forward on to her face. 2. adverb. Forward means in a position near the front of something such as a building or a vehicle.

10. www.yourdictionary.com › forwardForward Definition & Meaning | YourDictionary

    www.yourdictionary.com › forward

    • Cached

    At, toward, or of the front, or forepart. Webster's New World. Similar definitions. Located ahead or in advance. Kept her eye on the forward horizon. American Heritage. Moving toward a point in front; onward; advancing. Webster's New World. Similar definitions.

11. www.ldoceonline.com › dictionary › forwardforward | meaning of forward in Longman Dictionary of...

    www.ldoceonline.com › dictionary › forward

    • Cached

    forward meaning, definition, what is forward: towards a place or position that is in f...: Learn more.