Yahoo Canada Web Search

Search results

1. Dictionary

   forward

   /ˈfɔːwəd/

   adverb

   • 1. in the direction that one is facing or travelling; towards the front: "he started up the engine and the car moved forward" Similar aheadforwardsonwardsonwardonfurther
   • ▪ in or towards the bow or nose of a ship or aircraft.
   • ▪ in the normal order or sequence: "the number was the same backwards as forwards"
   • 2. onward so as to make progress: "the signing of the treaty is a big step forward" Similar moving forwardsmoving aheadonwardadvancingprogressingprogressiveOpposite backward
   • ▪ into a position of prominence or notice: "he is pushing forward a political ally" Similar towards the frontfrontwardsoutforthinto viewinto the openinto public noticeinto prominence
   • 3. towards the future; ahead in time: "looking forward, earnings are expected to hit £7.2 billion" Similar onwardonwardsonforthforwardsfor everinto eternityuntil now
   • ▪ to an earlier time: "the special issue has been moved forward to November"

   adjective

   • 1. directed or facing towards the front or the direction that one is facing or travelling: "forward flight" Similar moving forwardsmoving aheadonwardadvancingprogressingprogressiveOpposite backward
   • ▪ positioned near the enemy lines: "troops moved to the forward areas" Similar frontadvanceforemostheadleadingfrontalOpposite rear
   • ▪ situated in or towards the bow or nose of a ship or aircraft: "the forward cargo doors"
   • ▪ (of a voltage applied to a semiconductor junction) in the direction which allows significant current to flow.
   • 2. relating to the future: "a twelve-month forward forecast" Similar futureforward-lookingfor the futureprospective
   • 3. progressing towards a successful conclusion: "the decision is a forward step"
   • ▪ further advanced than expected or required: "an alarmingly forward yet painfully vulnerable child" Similar advancedwell advancedearlyprematureprecociousOpposite late
   • 4. (of a person) bold or overfamiliar in manner: "I am not usually a forward sort of person" Similar boldbrazenbrazen-facedbarefacedbrashshamelessimmodestaudaciousdaringpresumptuouspresumingassumingfamiliaroverfamiliarirreverentover-assertiveoverconfidentoverweeningaggressivethrustingpertimpudentimpertinentcheekyinsolentunabashedinformal:brass-neckedcockyfreshOpposite shy

   noun

   • 1. an attacking player in football, hockey, or other sports.
   • 2. agreements to trade specified assets, typically currency, at a specified price at a certain future date.

   verb

   • 1. send (a letter or email) on to a further destination: "my emails were forwarded to a friend" Similar send onredirectreaddresspass onpost on
   • ▪ dispatch or send (a document or goods): "we will forward the parcels to you anywhere in the world" Similar senddispatchtransmitcarryconveydeliverremitmailshipfreightpost
   • 2. help to advance (something); promote: "the scientists are forwarding the development of biotechnology" Similar advancefurtherhastenhurry alongexpediteacceleratespeed upstep upaidassisthelpfosterencouragecontribute topromotefavoursupportbackgive backing tofacilitate

   Word Origin Old Englishforweard (in the sense ‘towards the future’, as in from this day forward), variant of forthweard (see forth, -ward).

   Derivatives

   • 1. forwardly adverb

   Scrabble Points: 14

   • F

     4

   • O

     1

   • R

     1

   • W

     4

   • A

     1

   • R

     1

   • D

     2

   Powered by Oxford Dictionaries

   More definitions, origin and scrabble points

2. www.merriam-webster.com › dictionary › forwardForward Definition & Meaning - Merriam-Webster

   www.merriam-webster.com › dictionary › forward

   • Cached

   The meaning of FORWARD is near, being at, or belonging to the forepart. How to use forward in a sentence. Synonym Discussion of Forward.

3. dictionary.cambridge.org › dictionary › englishFORWARD | English meaning - Cambridge Dictionary

   dictionary.cambridge.org › dictionary › english

   • Cached

   FORWARD definition: 1. towards the direction that is in front of you: 2. towards the goal or area that is defended by…. Learn more.

4. Videos

   • 

     0:29

     youtube.com

     Forward Meaning

     Apr 15, 2015

     35.8K Views

   • 

     3:11

     youtube.com

     LOOK FORWARD TO - Phrasal Verb Meaning & Examples in English

     Mar 22, 2019

     29.2K Views

   • 

     2:08

     youtube.com

     Looking Forward to in English | Look Forward to - Phrasal Verb Meaning, Definition, and Examples

     Nov 23, 2021

     4.7K Views

   View all

5. www.collinsdictionary.com › dictionary › englishFORWARD definition and meaning | Collins English Dictionary

   www.collinsdictionary.com › dictionary › english

   • Cached

   16 meanings: 1. directed or moving ahead 2. lying or situated in or near the front part of something 3. presumptuous, pert, or.... Click for more definitions.

6. www.vocabulary.com › dictionary › forwardForward - Definition, Meaning & Synonyms - Vocabulary.com

   www.vocabulary.com › dictionary › forward

   Forward is the direction ahead of you, or toward the front of something. It can also be a position on a basketball, soccer, or hockey team.

7. People also ask

   What does forward mean?

   • The meaning of FORWARD is near, being at, or belonging to the forepart. How to use forward in a sentence. Synonym Discussion of Forward.

   Forward Definition & Meaning - Merriam-Webster

   www.merriam-webster.com/dictionary/forward

   See all results for this question

   How many meanings does the Word Forward have?

   • There are 47 meanings listed in OED's entry for the word forward, 17 of which are labelled obsolete. See ‘Meaning & use’ for definitions, usage, and quotation evidence. forward has developed meanings and uses in subjects including How common is the word forward? About 70 occurrences per million words in modern written English

   forward, adj., n., & adv. meanings, etymology and more | Oxford English

   www.oed.com/dictionary/forward_adj

   See all results for this question

   What is the difference between forward and onward?

   • SYNONYMS 1. forward, onward both indicate a direction toward the front or a movement in a frontward direction. forward applies to any movement toward what is or is conceived to be the front or a goal: to face forward; to move forward in the aisles. onward applies to any movement in continuance of a course: to march onward toward a goal. 8.

   FORWARD definition and meaning | Collins English Dictionary

   www.collinsdictionary.com/dictionary/english/forward

   See all results for this question

   How do you use forward in English?

   • You use forward to indicate that something progresses or improves. In British English, you can also use forwards. And by boosting economic prosperity in Mexico, Canada and the United States, it will help us move forward on issues that concern all of us. They just couldn't see any way forward.

   FORWARD definition and meaning | Collins English Dictionary

   www.collinsdictionary.com/dictionary/english/forward

   See all results for this question

   Is forward a verb or adverb?

   • In British English, forwards is often used as an adverb instead of forward in senses [sense 1], [sense 4], and [sense 7]. In addition to the uses shown below, forward is also used in phrasal verbs such as 'bring forward' and 'look forward to'.

   FORWARD definition and meaning | Collins English Dictionary

   www.collinsdictionary.com/dictionary/english/forward

   See all results for this question

   What does it mean if a car is forward?

   • Forward means in a position near the front of something such as a building or a vehicle. The best seats are in the aisle and as far forward as possible. The other car had a 3-inch lower driving seat and had its engine mounted further forward. Forward is also an adjective. Reinforcements were needed to allow more troops to move to forward positions.

   FORWARD definition and meaning | Collins English Dictionary

   www.collinsdictionary.com/dictionary/english/forward

   See all results for this question

8. dictionary.cambridge.org › learner-english › forwardFORWARD | definition in the Cambridge Learner’s Dictionary

   dictionary.cambridge.org › learner-english › forward

   • Cached

   Learn the meaning and usage of the word forward as an adverb, adjective, verb and noun in English. See translations of forward in different languages and examples of sentences with forward.

9. www.oed.com › dictionary › forward_adjforward, adj., n., & adv. meanings, etymology and more ...

   www.oed.com › dictionary › forward_adj

   • Cached

   Learn the meaning and history of the word forward, which can be an adjective, noun, or adverb. See examples of forward in different contexts, such as military, sports, and commerce.

10. www.collinsdictionary.com › english-word › forwardFORWARD - Meaning & Translations | Collins English Dictionary

    www.collinsdictionary.com › english-word › forward

    • Cached

    Master the word "FORWARD" in English: definitions, translations, synonyms, pronunciations, examples, and grammar insights - all in one complete resource.